Lineage for d3u6ka1 (3u6k A:8-204)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595370Protein automated matches [190047] (24 species)
    not a true protein
  7. 1595406Species Escherichia coli K-12 [TaxId:83333] [256110] (3 PDB entries)
  8. 1595409Domain d3u6ka1: 3u6k A:8-204 [250095]
    Other proteins in same PDB: d3u6ka2, d3u6ka3, d3u6kb2, d3u6kb3
    automated match to d1d8ta3
    complexed with gdp, mg

Details for d3u6ka1

PDB Entry: 3u6k (more details), 2.45 Å

PDB Description: Ef-tu (escherichia coli) in complex with nvp-ldk733
PDB Compounds: (A:) Elongation factor Tu 1

SCOPe Domain Sequences for d3u6ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u6ka1 c.37.1.8 (A:8-204) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeper

SCOPe Domain Coordinates for d3u6ka1:

Click to download the PDB-style file with coordinates for d3u6ka1.
(The format of our PDB-style files is described here.)

Timeline for d3u6ka1: