Lineage for d3tv8b2 (3tv8 B:324-422)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1555654Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1555976Protein Melibiase [75020] (4 species)
  7. 1555980Species Human (Homo sapiens) [TaxId:9606] [101919] (17 PDB entries)
    alpha-galactosidase A
  8. 1556000Domain d3tv8b2: 3tv8 B:324-422 [250039]
    Other proteins in same PDB: d3tv8a1, d3tv8b1
    automated match to d3hg3a2
    complexed with 2pe, dgj, nag, so4

Details for d3tv8b2

PDB Entry: 3tv8 (more details), 2.64 Å

PDB Description: pharmacological chaperoning in human alpha-galactosidase
PDB Compounds: (B:) Alpha-galactosidase A

SCOPe Domain Sequences for d3tv8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tv8b2 b.71.1.1 (B:324-422) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentmq

SCOPe Domain Coordinates for d3tv8b2:

Click to download the PDB-style file with coordinates for d3tv8b2.
(The format of our PDB-style files is described here.)

Timeline for d3tv8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tv8b1