Lineage for d3tqyd_ (3tqy D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1542164Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 1542165Protein automated matches [190576] (22 species)
    not a true protein
  7. 1542195Species Coxiella burnetii [TaxId:777] [233711] (2 PDB entries)
  8. 1542199Domain d3tqyd_: 3tqy D: [249993]
    automated match to d3ullb_

Details for d3tqyd_

PDB Entry: 3tqy (more details), 2.6 Å

PDB Description: structure of a single-stranded dna-binding protein (ssb), from coxiella burnetii
PDB Compounds: (D:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d3tqyd_:

Sequence, based on SEQRES records: (download)

>d3tqyd_ b.40.4.0 (D:) automated matches {Coxiella burnetii [TaxId: 777]}
rgvnkvilignlgqdpevrytpngnavanvtlatsttwrdkqtgelqertewhriaffnr
laeivgeylrkgskiyiegslrtrkwqdkngvdrytteiianemhmld

Sequence, based on observed residues (ATOM records): (download)

>d3tqyd_ b.40.4.0 (D:) automated matches {Coxiella burnetii [TaxId: 777]}
rgvnkvilignlgqdpevrytpngnavanvtlatsttertewhriaffnrlaeivgeylr
kgskiyiegslrtrkwqdkngvdrytteiianemhmld

SCOPe Domain Coordinates for d3tqyd_:

Click to download the PDB-style file with coordinates for d3tqyd_.
(The format of our PDB-style files is described here.)

Timeline for d3tqyd_: