Lineage for d3t6zc3 (3t6z C:305-495)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382415Species Steccherinum ochraceum [TaxId:92696] [256093] (5 PDB entries)
  8. 2382433Domain d3t6zc3: 3t6z C:305-495 [249822]
    automated match to d1gyca3
    complexed with cbs, cu, gol, so4

Details for d3t6zc3

PDB Entry: 3t6z (more details), 2.15 Å

PDB Description: crystal structure of steccherinum ochraceum laccase obtained by multi- crystals composite data collection technique (60% dose)
PDB Compounds: (C:) laccase

SCOPe Domain Sequences for d3t6zc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t6zc3 b.6.1.0 (C:305-495) automated matches {Steccherinum ochraceum [TaxId: 92696]}
ietdlhplsrngvpgnphqggadcnlnlslgfacgnfvingvsftpptvpvllqicsgan
taadllpsgsvislpsnstieialpagaaggphpfhlhghdfavsesasnstsnyddpiw
rdvvsiggvgdnvtirfctdnpgpwflhchidwhldagfaivfaedipntasanpvpeaw
snlcpsydsah

SCOPe Domain Coordinates for d3t6zc3:

Click to download the PDB-style file with coordinates for d3t6zc3.
(The format of our PDB-style files is described here.)

Timeline for d3t6zc3: