SCOPe 2.03: Domain d1chpd_: 1chp D:

Lineage for d1chpd_ (1chp D:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Cholera toxin [50208] (1 species)
   barrel, partly opened; n*=5, S*=10

7. Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
   Uniprot P01556 22-124

8. Domain d1chpd_: 1chp D: [24980]
   complexed with cl; mutant

Details for d1chpd_

PDB Entry: 1chp, 2 Å

PDB Description: surprising leads for a cholera toxin receptor binding antagonist; crystallographic studies of ctb mutants

PDB Compounds: (D:) cholera toxin b pentamer

SCOPe Domain Sequences for d1chpd_:

Sequence; same for both SEQRES and ATOM records:

>d1chpd_ b.40.2.1 (D:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsytesladkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

Timeline for d1chpd_:

• d1chpd_ first appeared (with stable ids) in SCOP 1.55
  
• d1chpd_ appears in SCOPe 2.02
  
• d1chpd_ appears in SCOPe 2.04
  
• d1chpd_ appears in the current release, SCOPe 2.08