Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (16 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
Domain d3t2pc4: 3t2p C:626-730 [249739] Other proteins in same PDB: d3t2pa1, d3t2pa3, d3t2pa5, d3t2pb1, d3t2pb3, d3t2pb5, d3t2pc1, d3t2pc3, d3t2pc5, d3t2pd1, d3t2pd3, d3t2pd5 automated match to d1jz8a2 complexed with dms, ipt, mg, na |
PDB Entry: 3t2p (more details), 2.6 Å
SCOPe Domain Sequences for d3t2pc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t2pc4 b.1.4.0 (C:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3t2pc4:
View in 3D Domains from same chain: (mouse over for more information) d3t2pc1, d3t2pc2, d3t2pc3, d3t2pc5 |