SCOPe 2.04: Domain d3si6a2: 3si6 A:376-903

Lineage for d3si6a2 (3si6 A:376-903)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)

6. Protein Family B DNA polymerase [56680] (7 species)

7. Species Bacteriophage RB69 [TaxId:12353] [56681] (92 PDB entries)

8. Domain d3si6a2: 3si6 A:376-903 [249475]
   Other proteins in same PDB: d3si6a1
   automated match to d3scxa2
   protein/DNA complex; complexed with dup, mg; mutant

Details for d3si6a2

PDB Entry: 3si6, 1.85 Å

PDB Description: RB69 DNA Polymerase Triple Mutant (L561A/S565G/Y567A) Ternary Complex with dUpNpp and a Deoxy-terminated Primer in the presence of Mg2+

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d3si6a2:

Sequence; same for both SEQRES and ATOM records:

>d3si6a2 e.8.1.1 (A:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkalinglagalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfaf

Timeline for d3si6a2:

• d3si6a2 is new in SCOPe 2.04-stable
  
• d3si6a2 appears in SCOPe 2.05
  
• d3si6a2 appears in the current release, SCOPe 2.08