![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.1: DNA polymerase I [56673] (5 proteins) |
![]() | Protein Family B DNA polymerase [56680] (7 species) |
![]() | Species Bacteriophage RB69 [TaxId:12353] [56681] (92 PDB entries) |
![]() | Domain d3si6a2: 3si6 A:376-903 [249475] Other proteins in same PDB: d3si6a1 automated match to d3scxa2 protein/DNA complex; complexed with dup, mg; mutant |
PDB Entry: 3si6 (more details), 1.85 Å
SCOPe Domain Sequences for d3si6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3si6a2 e.8.1.1 (A:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]} qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta qinrkalinglagalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfaf
Timeline for d3si6a2: