Lineage for d3sg1d_ (3sg1 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563801Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2563818Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2564034Family d.68.2.0: automated matches [191521] (1 protein)
    not a true family
  6. 2564035Protein automated matches [190878] (15 species)
    not a true protein
  7. 2564045Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [256082] (1 PDB entry)
  8. 2564049Domain d3sg1d_: 3sg1 D: [249438]
    automated match to d3vcya_
    complexed with pg4, pge

Details for d3sg1d_

PDB Entry: 3sg1 (more details), 2.6 Å

PDB Description: 2.6 angstrom crystal structure of udp-n-acetylglucosamine 1- carboxyvinyltransferase 1 (mura1) from bacillus anthracis
PDB Compounds: (D:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1

SCOPe Domain Sequences for d3sg1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sg1d_ d.68.2.0 (D:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mekiivrggkrlngtvrvegaknavlpiiaaallasdgknvlsevpvlsdvytinevlrh
lnaevvfennqvtidaskelnieapfeyvrkmrasvqvmgpllarngrarialpggcaig
srpidqhlkgfeamgakvqvgngfveayvegelkgakiyldfpsvgatenimsaatlakg
ttilenaakepeivdlanflnamgakvrgagtgtiriegvdklyganhsiipdrieagtf
mvaaaitggdilienavpehlrsitakmeemgvkiieenegvrvigpdklkavdiktmph
pgfptdmqsqmmalllqadgtsmitetvfenrfmhveefrrmnadikiegrsvimngpns
lqgaevgatdlraaaalilaglvsegytrvtelkhldrgyvdfhkklaalgatiervne

SCOPe Domain Coordinates for d3sg1d_:

Click to download the PDB-style file with coordinates for d3sg1d_.
(The format of our PDB-style files is described here.)

Timeline for d3sg1d_: