![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.28: NEAT domain-like [158911] (2 families) ![]() |
![]() | Family b.1.28.0: automated matches [195425] (1 protein) not a true family |
![]() | Protein automated matches [195426] (7 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158879] [233500] (8 PDB entries) |
![]() | Domain d3rurc1: 3rur C:341-456 [249219] Other proteins in same PDB: d3rurb2, d3rurc2, d3rurd2 automated match to d3rtlb_ complexed with hem, mg |
PDB Entry: 3rur (more details), 1.7 Å
SCOPe Domain Sequences for d3rurc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rurc1 b.1.28.0 (C:341-456) automated matches {Staphylococcus aureus [TaxId: 158879]} kmtdlqdtkyvvyesvennesmmdtfvkhpiktgmlngkkymvmettnddywkdfmvegq rvrtiskdaknntrtiifpyvegktlydaivkvhvktidydgqyhvrivdkeaftk
Timeline for d3rurc1: