SCOPe 2.07: Domain d3rurc1: 3rur C:341-456

Lineage for d3rurc1 (3rur C:341-456)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.0: automated matches [195425] (1 protein)
   not a true family

6. Protein automated matches [195426] (7 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [233500] (8 PDB entries)

8. Domain d3rurc1: 3rur C:341-456 [249219]
   Other proteins in same PDB: d3rurb2, d3rurc2, d3rurd2
   automated match to d3rtlb_
   complexed with hem, mg

Details for d3rurc1

PDB Entry: 3rur, 1.7 Å

PDB Description: staphylococcus aureus heme-bound selenomethionine-labeled isdb-n2

PDB Compounds: (C:) Iron-regulated surface determinant protein B

SCOPe Domain Sequences for d3rurc1:

Sequence; same for both SEQRES and ATOM records:

>d3rurc1 b.1.28.0 (C:341-456) automated matches {Staphylococcus aureus [TaxId: 158879]}
kmtdlqdtkyvvyesvennesmmdtfvkhpiktgmlngkkymvmettnddywkdfmvegq
rvrtiskdaknntrtiifpyvegktlydaivkvhvktidydgqyhvrivdkeaftk

Timeline for d3rurc1:

• d3rurc1 first appeared in SCOPe 2.04, called d3rurc_
  
• d3rurc1 appears in SCOPe 2.06
  
• d3rurc1 appears in the current release, SCOPe 2.08