SCOPe 2.07: Domain d3rsma1: 3rsm A:12-154

Lineage for d3rsma1 (3rsm A:12-154)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
   consists of three similar domains with 3 layers (a/b/a) each; duplication
   core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest

4. Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families)

5. Family c.84.1.0: automated matches [254314] (1 protein)
   not a true family

6. Protein automated matches [254721] (4 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [256063] (1 PDB entry)

8. Domain d3rsma1: 3rsm A:12-154 [249203]
   Other proteins in same PDB: d3rsma4
   automated match to d1k2yx1
   complexed with po4, zn; mutant

Details for d3rsma1

PDB Entry: 3rsm, 2.1 Å

PDB Description: Crystal structure of S108C mutant of PMM/PGM

PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d3rsma1:

Sequence, based on SEQRES records:

>d3rsma1 c.84.1.0 (A:12-154) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
sifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkqliqg
lvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgchnppdyngfkivvagetlaneqi
qalreriekndlasgvgsveqvd

Sequence, based on observed residues (ATOM records):

>d3rsma1 c.84.1.0 (A:12-154) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
sifraltaetaywigraigseslargepcvavgrdgrlsgpelvkqliqglvdcgcqvsd
vgmvptpvlyyaanvlegksgvmltgcngfkivvagetlaneqiqalreriekndlasgv
gsveqvd

Timeline for d3rsma1:

• d3rsma1 first appeared in SCOPe 2.04
  
• d3rsma1 appears in SCOPe 2.06
  
• d3rsma1 appears in the current release, SCOPe 2.08