Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries) |
Domain d3rmya1: 3rmy A:862-1067 [249180] Other proteins in same PDB: d3rmya2, d3rmyb2, d3rmyc2, d3rmyd2 automated match to d3pmea1 complexed with gol; mutant |
PDB Entry: 3rmy (more details), 2.3 Å
SCOPe Domain Sequences for d3rmya1:
Sequence, based on SEQRES records: (download)
>d3rmya1 b.29.1.0 (A:862-1067) automated matches {Clostridium botulinum [TaxId: 1491]} nsindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnn ilysaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrk ykslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldkti vfgidenidenqmlwirdfnifskel
>d3rmya1 b.29.1.0 (A:862-1067) automated matches {Clostridium botulinum [TaxId: 1491]} nsindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnn iaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrkyks lifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktivfg idenidenqmlwirdfnifskel
Timeline for d3rmya1: