SCOPe 2.07: Domain d3ri4d_: 3ri4 D:

Lineage for d3ri4d_ (3ri4 D:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein automated matches [191121] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193283] (15 PDB entries)

8. Domain d3ri4d_: 3ri4 D: [249125]
   automated match to d1gvjb_
   protein/DNA complex

Details for d3ri4d_

PDB Entry: 3ri4, 3 Å

PDB Description: ets1 cooperative binding to widely separated sites on promoter dna

PDB Compounds: (D:) Protein C-ets-1

SCOPe Domain Sequences for d3ri4d_:

Sequence; same for both SEQRES and ATOM records:

>d3ri4d_ a.4.5.21 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtfkdyvrdradlnkdkpvipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgw
efklsdpdevarrwgkrknkpkmnyeklsrglryyydkniihktagkryvyrfvcdlqsl
lgytpeelhamldvkp

Timeline for d3ri4d_:

• d3ri4d_ first appeared in SCOPe 2.04
  
• d3ri4d_ appears in SCOPe 2.06
  
• d3ri4d_ appears in the current release, SCOPe 2.08