Lineage for d3qpbe_ (3qpb E:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1608160Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1608177Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1608995Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 1608996Protein automated matches [190781] (30 species)
    not a true protein
  7. 1609139Species Streptococcus pyogenes [TaxId:301450] [256042] (1 PDB entry)
  8. 1609144Domain d3qpbe_: 3qpb E: [248953]
    automated match to d2b94a_
    complexed with r1p, ura

Details for d3qpbe_

PDB Entry: 3qpb (more details), 1.82 Å

PDB Description: crystal structure of streptococcus pyogenes uridine phosphorylase reveals a subclass of the np-i superfamily
PDB Compounds: (E:) Uridine phosphorylase

SCOPe Domain Sequences for d3qpbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qpbe_ c.56.2.0 (E:) automated matches {Streptococcus pyogenes [TaxId: 301450]}
vglqyhlqirpgdvgryvimpgdpkrcakiaehfdnavlvadsreyvtytgtlngekvsv
tstgiggpsasiameelklcgadtfirvgtcggieldvkggdiviatgairmegtskeya
piefpavadlevtnalvnaakklgytshagvvqckdafygqhepermpvsyellnkweaw
krlgtkasemesaalfvaashlgvrcgsdflvvgnqernalgmdnpmahdteaaiqvave
alrtliend

SCOPe Domain Coordinates for d3qpbe_:

Click to download the PDB-style file with coordinates for d3qpbe_.
(The format of our PDB-style files is described here.)

Timeline for d3qpbe_: