Class a: All alpha proteins [46456] (289 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (2 families) automatically mapped to Pfam PF00373 |
Family a.11.2.0: automated matches [254193] (1 protein) not a true family |
Protein automated matches [254423] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255207] (60 PDB entries) |
Domain d3qijb2: 3qij B:291-396 [248906] Other proteins in same PDB: d3qija1, d3qija3, d3qija4, d3qijb1, d3qijb3, d3qijb4 automated match to d1gg3a1 complexed with unx |
PDB Entry: 3qij (more details), 1.8 Å
SCOPe Domain Sequences for d3qijb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qijb2 a.11.2.0 (B:291-396) automated matches {Human (Homo sapiens) [TaxId: 9606]} pdpaqlteditryylclqlrqdivagrlpcsfatlallgsytiqselgdydpelhgvdyv sdfklapnqtkeleekvmelhksyrsmtpaqadleflenakklsmy
Timeline for d3qijb2:
View in 3D Domains from other chains: (mouse over for more information) d3qija1, d3qija2, d3qija3, d3qija4 |