Lineage for d3qa3i_ (3qa3 I:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892209Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species)
  7. 2892210Species Human (Homo sapiens) [TaxId:9606] [53309] (13 PDB entries)
  8. 2892224Domain d3qa3i_: 3qa3 I: [248820]
    Other proteins in same PDB: d3qa3a1, d3qa3a2, d3qa3b1, d3qa3b2, d3qa3c1, d3qa3c2, d3qa3d1, d3qa3d2, d3qa3f1, d3qa3f2, d3qa3h1, d3qa3h2, d3qa3j1, d3qa3j2, d3qa3k1, d3qa3k2
    automated match to d3q3ge_
    complexed with ca, edo, gol

Details for d3qa3i_

PDB Entry: 3qa3 (more details), 3 Å

PDB Description: Crystal Structure of A-domain in complex with antibody
PDB Compounds: (I:) Integrin alpha-M

SCOPe Domain Sequences for d3qa3i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qa3i_ c.62.1.1 (I:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
lrekg

SCOPe Domain Coordinates for d3qa3i_:

Click to download the PDB-style file with coordinates for d3qa3i_.
(The format of our PDB-style files is described here.)

Timeline for d3qa3i_: