SCOPe 2.08: Domain d3qa3a2: 3qa3 A:114-220

Lineage for d3qa3a2 (3qa3 A:114-220)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3qa3a2: 3qa3 A:114-220 [248813]
   Other proteins in same PDB: d3qa3a1, d3qa3b1, d3qa3b2, d3qa3c1, d3qa3d1, d3qa3d2, d3qa3e_, d3qa3f1, d3qa3g_, d3qa3h1, d3qa3h2, d3qa3i_, d3qa3j1, d3qa3k1, d3qa3k2, d3qa3l_
   complexed with ca, edo, gol

Details for d3qa3a2

PDB Entry: 3qa3, 3 Å

PDB Description: Crystal Structure of A-domain in complex with antibody

PDB Compounds: (A:) Antibody Light Chain

SCOPe Domain Sequences for d3qa3a2:

Sequence; same for both SEQRES and ATOM records:

>d3qa3a2 b.1.1.2 (A:114-220) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d3qa3a2:

• d3qa3a2 first appeared in SCOPe 2.04
  
• d3qa3a2 appears in SCOPe 2.07