Lineage for d3qa3a2 (3qa3 A:114-220)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752838Domain d3qa3a2: 3qa3 A:114-220 [248813]
    Other proteins in same PDB: d3qa3a1, d3qa3b1, d3qa3b2, d3qa3c1, d3qa3d1, d3qa3d2, d3qa3e_, d3qa3f1, d3qa3g_, d3qa3h1, d3qa3h2, d3qa3i_, d3qa3j1, d3qa3k1, d3qa3k2, d3qa3l_
    complexed with ca, edo, gol

Details for d3qa3a2

PDB Entry: 3qa3 (more details), 3 Å

PDB Description: Crystal Structure of A-domain in complex with antibody
PDB Compounds: (A:) Antibody Light Chain

SCOPe Domain Sequences for d3qa3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qa3a2 b.1.1.2 (A:114-220) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d3qa3a2:

Click to download the PDB-style file with coordinates for d3qa3a2.
(The format of our PDB-style files is described here.)

Timeline for d3qa3a2: