Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
Protein automated matches [190858] (12 species) not a true protein |
Species Deinococcus radiodurans [TaxId:1299] [226279] (2 PDB entries) |
Domain d3q9vb_: 3q9v B: [248811] automated match to d2pmub_ |
PDB Entry: 3q9v (more details), 1.6 Å
SCOPe Domain Sequences for d3q9vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q9vb_ a.4.6.0 (B:) automated matches {Deinococcus radiodurans [TaxId: 1299]} seslsmgdltldpqkrlvtykgeelrlspkefdilallirqpgrvysrqeigqeiwqgrl pegsnvvdvhmanlraklrdldgygllrtvrgvgyalrg
Timeline for d3q9vb_: