Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (29 species) not a true protein |
Species Trametes hirsuta [TaxId:5327] [255835] (4 PDB entries) |
Domain d3pxla2: 3pxl A:131-300 [248728] automated match to d1kyaa2 complexed with cu, nag |
PDB Entry: 3pxl (more details), 1.2 Å
SCOPe Domain Sequences for d3pxla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pxla2 b.6.1.0 (A:131-300) automated matches {Trametes hirsuta [TaxId: 5327]} dphasrydvdnddtvitladwyhtaaklgprfpggadatlingkgrapsdsvaelsvikv tkgkryrfrlvslscnpnhtfsidghnltiievdsvnsqplevdsiqifaaqrysfvlda nqavdnywiranpnfgnvgfdgginsailrydgapavepttnqttsvkpl
Timeline for d3pxla2: