Lineage for d2sns__ (2sns -)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228552Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 228553Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
    barrel, closed; n=5, S=10
  6. 228554Protein Staphylococcal nuclease [50201] (1 species)
  7. 228555Species Staphylococcus aureus [TaxId:1280] [50202] (56 PDB entries)
  8. 228603Domain d2sns__: 2sns - [24860]
    complexed with ca, ptp

Details for d2sns__

PDB Entry: 2sns (more details), 1.5 Å

PDB Description: staphylococcal nuclease. proposed mechanism of action based on structure of enzyme-thymidine 3(prime),5(prime)-biphosphate-calcium ion complex at 1.5-angstroms resolution

SCOP Domain Sequences for d2sns__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sns__ b.40.1.1 (-) Staphylococcal nuclease {Staphylococcus aureus}
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmvenakkievefnkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
heqhlrkseaqakkeklniws

SCOP Domain Coordinates for d2sns__:

Click to download the PDB-style file with coordinates for d2sns__.
(The format of our PDB-style files is described here.)

Timeline for d2sns__: