Lineage for d3ppsc2 (3pps C:164-343)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382461Species Thielavia arenaria [TaxId:113610] [256023] (1 PDB entry)
  8. 2382469Domain d3ppsc2: 3pps C:164-343 [248562]
    automated match to d2q9oa2
    complexed with cu, nag, oxy

Details for d3ppsc2

PDB Entry: 3pps (more details), 2.5 Å

PDB Description: crystal structure of an ascomycete fungal laccase from thielavia arenaria
PDB Compounds: (C:) laccase

SCOPe Domain Sequences for d3ppsc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ppsc2 b.6.1.0 (C:164-343) automated matches {Thielavia arenaria [TaxId: 113610]}
ydidlgvfplmdyyyrsadelvhftqsngappsdnvlfngtarhpetgagqwynvtltpg
krhrlriintstdnhfqvslvghnmtviatdmvpvnaftvsslflavgqrydvtidansp
vgnywfnvtfgdglcgssnnkfpaaifryqgapatlptdqglpvpnhmcldnlnltpvvt

SCOPe Domain Coordinates for d3ppsc2:

Click to download the PDB-style file with coordinates for d3ppsc2.
(The format of our PDB-style files is described here.)

Timeline for d3ppsc2: