Lineage for d1aexa_ (1aex A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313474Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 1313475Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1313476Protein Staphylococcal nuclease [50201] (1 species)
  7. 1313477Species Staphylococcus aureus [TaxId:1280] [50202] (186 PDB entries)
    Uniprot P00644 89-223
  8. 1313620Domain d1aexa_: 1aex A: [24854]
    complexed with ca, thp

Details for d1aexa_

PDB Entry: 1aex (more details), 2.1 Å

PDB Description: staphylococcal nuclease, methane thiol disulfide to v23c variant
PDB Compounds: (A:) staphylococcal nuclease

SCOPe Domain Sequences for d1aexa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aexa_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtcklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
kseaqakkeklniws

SCOPe Domain Coordinates for d1aexa_:

Click to download the PDB-style file with coordinates for d1aexa_.
(The format of our PDB-style files is described here.)

Timeline for d1aexa_: