![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) ![]() |
![]() | Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
![]() | Protein automated matches [193506] (4 species) not a true protein |
![]() | Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (36 PDB entries) |
![]() | Domain d3pmzd_: 3pmz D: [248533] automated match to d2c9ta_ complexed with mg, tub |
PDB Entry: 3pmz (more details), 2.44 Å
SCOPe Domain Sequences for d3pmzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pmzd_ b.96.1.0 (D:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} kdddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvy yeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgs vmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyassky eilsatqtrqvqhysccpepyidvnlvvkfrerr
Timeline for d3pmzd_: