Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Bartonella henselae [TaxId:38323] [255930] (2 PDB entries) |
Domain d3pgzb1: 3pgz B:3-115 [248496] Other proteins in same PDB: d3pgza2, d3pgzb2 automated match to d1eqqb_ complexed with unx |
PDB Entry: 3pgz (more details), 2.1 Å
SCOPe Domain Sequences for d3pgzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pgzb1 b.40.4.0 (B:3-115) automated matches {Bartonella henselae [TaxId: 38323]} gslnkvilignlgadpeirrlnsgdqvanlriatseswrdrntnerkertewhnivifne nlvkvveqylkkgskiyiegqlqtrkwqdqngndrytteivlqkyrgelqmld
Timeline for d3pgzb1: