Lineage for d3pgzb1 (3pgz B:3-115)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400043Species Bartonella henselae [TaxId:38323] [255930] (2 PDB entries)
  8. 2400045Domain d3pgzb1: 3pgz B:3-115 [248496]
    Other proteins in same PDB: d3pgza2, d3pgzb2
    automated match to d1eqqb_
    complexed with unx

Details for d3pgzb1

PDB Entry: 3pgz (more details), 2.1 Å

PDB Description: crystal structure of a single strand binding protein (ssb) from bartonella henselae
PDB Compounds: (B:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d3pgzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pgzb1 b.40.4.0 (B:3-115) automated matches {Bartonella henselae [TaxId: 38323]}
gslnkvilignlgadpeirrlnsgdqvanlriatseswrdrntnerkertewhnivifne
nlvkvveqylkkgskiyiegqlqtrkwqdqngndrytteivlqkyrgelqmld

SCOPe Domain Coordinates for d3pgzb1:

Click to download the PDB-style file with coordinates for d3pgzb1.
(The format of our PDB-style files is described here.)

Timeline for d3pgzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pgzb2