SCOPe 2.04: Domain d3pbra1: 3pbr A:54-221

Lineage for d3pbra1 (3pbr A:54-221)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (7 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [228776] (12 PDB entries)

8. Domain d3pbra1: 3pbr A:54-221 [248456]
   Other proteins in same PDB: d3pbra2
   automated match to d3pboa1
   complexed with mer

Details for d3pbra1

PDB Entry: 3pbr, 1.95 Å

PDB Description: Crystal structure of PBP3 complexed with meropenem

PDB Compounds: (A:) penicillin-binding protein 3

SCOPe Domain Sequences for d3pbra1:

Sequence; same for both SEQRES and ATOM records:

>d3pbra1 d.175.1.0 (A:54-221) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
rhiaipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfadr
ieqnaerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvddr
gregielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal

Timeline for d3pbra1:

• d3pbra1 is new in SCOPe 2.04-stable
  
• d3pbra1 appears in SCOPe 2.05
  
• d3pbra1 appears in the current release, SCOPe 2.08