Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Bordetella bronchiseptica [TaxId:518] [256002] (4 PDB entries) |
Domain d3ozyb1: 3ozy B:4-132 [248396] Other proteins in same PDB: d3ozya2, d3ozya3, d3ozyb2, d3ozyb3 automated match to d3sjna1 complexed with acy, dxl, gol, mg |
PDB Entry: 3ozy (more details), 1.3 Å
SCOPe Domain Sequences for d3ozyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ozyb1 d.54.1.0 (B:4-132) automated matches {Bordetella bronchiseptica [TaxId: 518]} kitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavlkr aiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgramn qpiyqllgg
Timeline for d3ozyb1: