SCOPe 2.04: Domain d3ozwb2: 3ozw B:151-261

Lineage for d3ozwb2 (3ozw B:151-261)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (16 species)
   not a true protein

7. Species Ralstonia eutropha [TaxId:381666] [256010] (3 PDB entries)

8. Domain d3ozwb2: 3ozw B:151-261 [248392]
   Other proteins in same PDB: d3ozwa1, d3ozwa3, d3ozwb1, d3ozwb3
   automated match to d1cqxa2
   complexed with dgg, fad, hem, kkk, po4

Details for d3ozwb2

PDB Entry: 3ozw, 2.3 Å

PDB Description: The Crystal Structure of flavohemoglobin from R. eutrophus in complex with ketoconazole

PDB Compounds: (B:) Flavohemoglobin

SCOPe Domain Sequences for d3ozwb2:

Sequence; same for both SEQRES and ATOM records:

>d3ozwb2 b.43.4.0 (B:151-261) automated matches {Ralstonia eutropha [TaxId: 381666]}
wkgwrtfvirekrpesdvitsfilepadggpvvnfepgqytsvaidvpalglqqirqysl
sdmpngrsyrisvkregggpqppgyvsnllhdhvnvgdqvklaapygsfhi

Timeline for d3ozwb2:

• d3ozwb2 is new in SCOPe 2.04-stable
  
• d3ozwb2 appears in SCOPe 2.05
  
• d3ozwb2 appears in the current release, SCOPe 2.08