Class b: All beta proteins [48724] (119 folds) |
Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) |
Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein) barrel, closed; n=5, S=10 |
Protein Staphylococcal nuclease [50201] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [50202] (56 PDB entries) |
Domain d3nuc__: 3nuc - [24836] complexed with ca, thp; mutant |
PDB Entry: 3nuc (more details), 1.9 Å
SCOP Domain Sequences for d3nuc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nuc__ b.40.1.1 (-) Staphylococcal nuclease {Staphylococcus aureus} lhkepatlikaidgdtcklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr kseaqakkeklniws
Timeline for d3nuc__: