SCOPe 2.07: Domain d3ouzb3: 3ouz B:330-443

Lineage for d3ouzb3 (3ouz B:330-443)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.0: automated matches [254217] (1 protein)
   not a true family

6. Protein automated matches [254496] (16 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [256008] (2 PDB entries)

8. Domain d3ouzb3: 3ouz B:330-443 [248351]
   Other proteins in same PDB: d3ouza1, d3ouza2, d3ouza4, d3ouzb1, d3ouzb2
   automated match to d1ulza1
   complexed with adp, fmt, gol, mg, mlt, srt, tla

Details for d3ouzb3

PDB Entry: 3ouz, 1.9 Å

PDB Description: crystal structure of biotin carboxylase-adp complex from campylobacter jejuni

PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d3ouzb3:

Sequence; same for both SEQRES and ATOM records:

>d3ouzb3 b.84.2.0 (B:330-443) automated matches {Campylobacter jejuni [TaxId: 192222]}
lnghsiecritaedsktflpspgkitkyippagrnvrmeshcyqdysvpayydsmigklv
vwaedrnkaiakmkvaldellisgikttkdfhlsmmenpdfinnnydtnylarh

Timeline for d3ouzb3:

• d3ouzb3 first appeared in SCOPe 2.04
  
• d3ouzb3 appears in SCOPe 2.06
  
• d3ouzb3 appears in the current release, SCOPe 2.08