Class b: All beta proteins [48724] (178 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) |
Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
Protein automated matches [254496] (16 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [256008] (2 PDB entries) |
Domain d3ouzb3: 3ouz B:330-443 [248351] Other proteins in same PDB: d3ouza1, d3ouza2, d3ouza4, d3ouzb1, d3ouzb2 automated match to d1ulza1 complexed with adp, fmt, gol, mg, mlt, srt, tla |
PDB Entry: 3ouz (more details), 1.9 Å
SCOPe Domain Sequences for d3ouzb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ouzb3 b.84.2.0 (B:330-443) automated matches {Campylobacter jejuni [TaxId: 192222]} lnghsiecritaedsktflpspgkitkyippagrnvrmeshcyqdysvpayydsmigklv vwaedrnkaiakmkvaldellisgikttkdfhlsmmenpdfinnnydtnylarh
Timeline for d3ouzb3:
View in 3D Domains from other chains: (mouse over for more information) d3ouza1, d3ouza2, d3ouza3, d3ouza4 |