Lineage for d1syc__ (1syc -)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228552Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 228553Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
    barrel, closed; n=5, S=10
  6. 228554Protein Staphylococcal nuclease [50201] (1 species)
  7. 228555Species Staphylococcus aureus [TaxId:1280] [50202] (56 PDB entries)
  8. 228575Domain d1syc__: 1syc - [24829]
    mutant

Details for d1syc__

PDB Entry: 1syc (more details), 1.8 Å

PDB Description: engineering alternative beta-turn types in staphylococcal nuclease

SCOP Domain Sequences for d1syc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syc__ b.40.1.1 (-) Staphylococcal nuclease {Staphylococcus aureus}
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqhl
rkseaqakkeklniws

SCOP Domain Coordinates for d1syc__:

Click to download the PDB-style file with coordinates for d1syc__.
(The format of our PDB-style files is described here.)

Timeline for d1syc__: