Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries) |
Domain d3ogga1: 3ogg A:863-1067 [248253] Other proteins in same PDB: d3ogga2 automated match to d3pmea1 |
PDB Entry: 3ogg (more details), 1.65 Å
SCOPe Domain Sequences for d3ogga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ogga1 b.29.1.0 (A:863-1067) automated matches {Clostridium botulinum [TaxId: 1491]} sindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnni lysaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrky kslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktiv fgidenidenqmlwirdfnifskel
Timeline for d3ogga1: