Lineage for d1sth__ (1sth -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) 
Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein) Protein Staphylococcal nuclease [50201] (1 species) Species Staphylococcus aureus [TaxId:1280] [50202] (52 PDB entries) 
Domain d1sth__: 1sth - [24824]
Details for d1sth__
PDB Entry: 1sth (more details), 1.85 Å
PDB Description: two distinctly different metal binding modes are seen in x-ray crystal structures of staphylococcal nuclease-cobalt(ii)-nucleotide complexes
SCOP Domain Sequences for d1sth__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sth__ b.40.1.1 (-) Staphylococcal nuclease {Staphylococcus aureus}
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhl
rkseaqakkeklniws
SCOP Domain Coordinates for d1sth__:
Click to download the PDB-style file with coordinates for d1sth__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sth__:
- d1sth__ appears in SCOP 1.57
- d1sth__ appears in the current release, SCOPe 2.08, called d1stha_
View in 3D