PDB entry 1sth

View 1sth on RCSB PDB site
Description: two distinctly different metal binding modes are seen in x-ray crystal structures of staphylococcal nuclease-cobalt(ii)-nucleotide complexes
Deposited on 1994-10-27, released 1995-02-27
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: -
Resolution: 1.85 Å
R-factor: 0.174
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1sth__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sth_ (-)
  klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
  venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhl
  rkseaqakkeklniws