Lineage for d1ey0a_ (1ey0 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 296801Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 296802Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
    barrel, closed; n=5, S=10
  6. 296803Protein Staphylococcal nuclease [50201] (1 species)
  7. 296804Species Staphylococcus aureus [TaxId:1280] [50202] (59 PDB entries)
  8. 296809Domain d1ey0a_: 1ey0 A: [24817]

Details for d1ey0a_

PDB Entry: 1ey0 (more details), 1.6 Å

PDB Description: structure of wild-type s. nuclease at 1.6 a resolution

SCOP Domain Sequences for d1ey0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ey0a_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus}
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhl
rkseaqakkeklniws

SCOP Domain Coordinates for d1ey0a_:

Click to download the PDB-style file with coordinates for d1ey0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ey0a_: