SCOP 1.59: Domain d1sty__: 1sty -

Lineage for d1sty__ (1sty -)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family)

5. Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)

6. Protein Staphylococcal nuclease [50201] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50202] (56 PDB entries)

8. Domain d1sty__: 1sty - [24812]

Details for d1sty__

PDB Entry: 1sty, 1.67 Å

PDB Description: the alpha aneurism: a structural motif revealed in an insertion mutant of staphylococcal nuclease

SCOP Domain Sequences for d1sty__:

Sequence; same for both SEQRES and ATOM records:

>d1sty__ b.40.1.1 (-) Staphylococcal nuclease {Staphylococcus aureus}
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhl
rgkseaqakkeklniws

Timeline for d1sty__:

• d1sty__ first appeared (with stable ids) in SCOP 1.55
  
• d1sty__ appears in SCOP 1.57
  
• d1sty__ appears in SCOP 1.61
  
• d1sty__ appears in the current release, SCOPe 2.08, called d1stya_