Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (78 species) not a true protein |
Species Marine actinobacterium [TaxId:312284] [255974] (3 PDB entries) |
Domain d3no1f2: 3no1 F:148-382 [247988] Other proteins in same PDB: d3no1a1, d3no1b1, d3no1c1, d3no1d1, d3no1e1, d3no1f1 automated match to d3bjsa2 complexed with mg |
PDB Entry: 3no1 (more details), 2.16 Å
SCOPe Domain Sequences for d3no1f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3no1f2 c.1.11.0 (F:148-382) automated matches {Marine actinobacterium [TaxId: 312284]} yrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaag ddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcag qtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthl lasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidq
Timeline for d3no1f2: