Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (78 species) not a true protein |
Species Chromohalobacter salexigens [TaxId:290398] [232967] (8 PDB entries) |
Domain d3nfua2: 3nfu A:133-440 [247902] Other proteins in same PDB: d3nfua1, d3nfua3, d3nfua4, d3nfub1, d3nfub3, d3nfub4 automated match to d3mznb2 complexed with gol, mg, so4 |
PDB Entry: 3nfu (more details), 1.94 Å
SCOPe Domain Sequences for d3nfua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nfua2 c.1.11.0 (A:133-440) automated matches {Chromohalobacter salexigens [TaxId: 290398]} qygrqrdevealgylfllgdpdktdlpyprvadpvdawdevryreamtpeavanlaraay drygfkdfklkggvlrgeeeadciralheafpearlaldpngawkldeavrvlepikhll syaedpcgqeggfsgretmaefkkrtglptatnmiatdykqlqyavqlnsvdipladchf wtmqgavavgelcnewgmtwgshsnnhfdislammthvaaacpgeitaidthwiwqdgqr itrepfqirdgkltvpktpglgieldddklmeahetykrldvtqrndamamqylipgwef dpkrpalv
Timeline for d3nfua2:
View in 3D Domains from other chains: (mouse over for more information) d3nfub1, d3nfub2, d3nfub3, d3nfub4 |