Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries) |
Domain d3nfua1: 3nfu A:2-132 [247901] Other proteins in same PDB: d3nfua2, d3nfua3, d3nfua4, d3nfub2, d3nfub3, d3nfub4 automated match to d3mznb1 complexed with gol, mg, so4 |
PDB Entry: 3nfu (more details), 1.94 Å
SCOPe Domain Sequences for d3nfua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nfua1 d.54.1.0 (A:2-132) automated matches {Chromohalobacter salexigens [TaxId: 290398]} fpkitkmnvvpvagedgfllnlsgghepwfircvlvledesgnrgvgeipssegilngle kcrslvegarvnevkqvlsrargllaqggpeergrqtfdlrvavhvitaiesalfdlfgq algmpvadllg
Timeline for d3nfua1:
View in 3D Domains from other chains: (mouse over for more information) d3nfub1, d3nfub2, d3nfub3, d3nfub4 |