SCOPe 2.07: Domain d3n7la2: 3n7l A:1077-1284

Lineage for d3n7la2 (3n7l A:1077-1284)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.0: automated matches [191368] (1 protein)
   not a true family

6. Protein automated matches [190445] (10 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [225676] (22 PDB entries)

8. Domain d3n7la2: 3n7l A:1077-1284 [247866]
   Other proteins in same PDB: d3n7la1
   automated match to d3r4sa2
   complexed with gol, so4

Details for d3n7la2

PDB Entry: 3n7l, 2 Å

PDB Description: crystal structure of botulinum neurotoxin serotype d/c vpi 5993 binding domain

PDB Compounds: (A:) Neurotoxin

SCOPe Domain Sequences for d3n7la2:

Sequence; same for both SEQRES and ATOM records:

>d3n7la2 b.42.4.0 (A:1077-1284) automated matches {Clostridium botulinum [TaxId: 1491]}
ddkdinilfnslqytnvvkdywgndlrydkeyyminvnymnrymskkgngivfntrknnn
dfnegykiiikrirgntndtrvrgenvlyfnttidnkqyslgmykpsrnlgtdlvplgal
dqpmdeirkygsfiiqpcntfdyyasqlflssnattnrlgilsigsysfklgddywfnhe
ylipvikiehyaslleststhwvfvpas

Timeline for d3n7la2:

• d3n7la2 first appeared in SCOPe 2.04
  
• d3n7la2 appears in SCOPe 2.06
  
• d3n7la2 appears in the current release, SCOPe 2.08