Lineage for d3m1be1 (3m1b E:5-176)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938887Domain d3m1be1: 3m1b E:5-176 [247570]
    Other proteins in same PDB: d3m1ba2, d3m1bb_, d3m1bc2, d3m1bd_, d3m1be2, d3m1bf_, d3m1bg2, d3m1bh_
    automated match to d3frua2

Details for d3m1be1

PDB Entry: 3m1b (more details), 3.1 Å

PDB Description: crystal structure of human fcrn with a dimeric peptide inhibitor
PDB Compounds: (E:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d3m1be1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m1be1 d.19.1.0 (E:5-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswyweke
ttdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlkq
gtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew

SCOPe Domain Coordinates for d3m1be1:

Click to download the PDB-style file with coordinates for d3m1be1.
(The format of our PDB-style files is described here.)

Timeline for d3m1be1: