Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d3m1be1: 3m1b E:5-176 [247570] Other proteins in same PDB: d3m1ba2, d3m1bb_, d3m1bc2, d3m1bd_, d3m1be2, d3m1bf_, d3m1bg2, d3m1bh_ automated match to d3frua2 |
PDB Entry: 3m1b (more details), 3.1 Å
SCOPe Domain Sequences for d3m1be1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m1be1 d.19.1.0 (E:5-176) automated matches {Human (Homo sapiens) [TaxId: 9606]} lsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswyweke ttdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlkq gtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew
Timeline for d3m1be1: