Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (28 species) not a true protein |
Species Streptococcus mutans [TaxId:210007] [255927] (1 PDB entry) |
Domain d3ld2c_: 3ld2 C: [247444] automated match to d2ae6c_ complexed with coa |
PDB Entry: 3ld2 (more details), 2.5 Å
SCOPe Domain Sequences for d3ld2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ld2c_ d.108.1.0 (C:) automated matches {Streptococcus mutans [TaxId: 210007]} mkispmllsdieqvvelenktwseqntpvplpvaskdqiiqkfesnthflvakikdkivg vldysslypfpsgqhivtfgiavaekerrkgigralvqiflnevksdyqkvlihvlssnq eavlfykklgfdlearltkqfflkgqyvddliysydle
Timeline for d3ld2c_: