Lineage for d3ld2c_ (3ld2 C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664807Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1664808Protein automated matches [190038] (28 species)
    not a true protein
  7. 1664953Species Streptococcus mutans [TaxId:210007] [255927] (1 PDB entry)
  8. 1664956Domain d3ld2c_: 3ld2 C: [247444]
    automated match to d2ae6c_
    complexed with coa

Details for d3ld2c_

PDB Entry: 3ld2 (more details), 2.5 Å

PDB Description: The Crystal Structure of smu.2055 from Streptococcus mutans UA159
PDB Compounds: (C:) putative acetyltransferase

SCOPe Domain Sequences for d3ld2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ld2c_ d.108.1.0 (C:) automated matches {Streptococcus mutans [TaxId: 210007]}
mkispmllsdieqvvelenktwseqntpvplpvaskdqiiqkfesnthflvakikdkivg
vldysslypfpsgqhivtfgiavaekerrkgigralvqiflnevksdyqkvlihvlssnq
eavlfykklgfdlearltkqfflkgqyvddliysydle

SCOPe Domain Coordinates for d3ld2c_:

Click to download the PDB-style file with coordinates for d3ld2c_.
(The format of our PDB-style files is described here.)

Timeline for d3ld2c_: