![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) ![]() automatically mapped to Pfam PF02939 |
![]() | Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins) |
![]() | Protein automated matches [191133] (1 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [189229] (8 PDB entries) |
![]() | Domain d3l73t_: 3l73 T: [247409] Other proteins in same PDB: d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73u_, d3l73w_ automated match to d3l75g_ complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq |
PDB Entry: 3l73 (more details), 3.04 Å
SCOPe Domain Sequences for d3l73t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l73t_ f.23.13.1 (T:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} ihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllysw gtqeferlkrknpadyend
Timeline for d3l73t_:
![]() Domains from other chains: (mouse over for more information) d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73u_, d3l73w_ |