![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.0: automated matches [232765] (1 protein) not a true family |
![]() | Protein automated matches [232766] (2 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries) |
![]() | Domain d3l73n1: 3l73 N:3-233 [247400] Other proteins in same PDB: d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73t_, d3l73u_, d3l73w_ automated match to d3l71a1 complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq |
PDB Entry: 3l73 (more details), 3.04 Å
SCOPe Domain Sequences for d3l73n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l73n1 d.185.1.0 (N:3-233) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} tyaqtlqnipetnvttldnglrvaseessqptctvgvwigagsryeneknngagyfvehl afkgtkkrpcaafekevesmgahfngytsreqtafyikalskdmpkvvelladvvqncal eesqiekergvilqelkemdndmtnvtfdylhatafqgtalartvegttenikhltradl asyidthfkaprmvlaaaggishkelvdaarqhfsgvsftykedavpilpr
Timeline for d3l73n1:
![]() Domains from other chains: (mouse over for more information) d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73t_, d3l73u_, d3l73w_ |