Lineage for d3l72q1 (3l72 Q:1-195)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691442Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 2691486Protein automated matches [232767] (3 species)
    not a true protein
  7. 2691491Species Chicken (Gallus gallus) [TaxId:9031] [232780] (8 PDB entries)
  8. 2691503Domain d3l72q1: 3l72 Q:1-195 [247382]
    Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d2, d3l72e1, d3l72e2, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q2, d3l72r1, d3l72r2, d3l72s_, d3l72t_, d3l72u_, d3l72w_
    automated match to d3l71d1
    complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq

Details for d3l72q1

PDB Entry: 3l72 (more details), 3.06 Å

PDB Description: chicken cytochrome bc1 complex with kresoxim-i-dimethyl bound
PDB Compounds: (Q:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3l72q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l72q1 a.3.1.3 (Q:1-195) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae
akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar
hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms
qiakdvctflrwaae

SCOPe Domain Coordinates for d3l72q1:

Click to download the PDB-style file with coordinates for d3l72q1.
(The format of our PDB-style files is described here.)

Timeline for d3l72q1: