Lineage for d3huda1 (3hud A:1-162,A:339-374)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2394951Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2394952Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2395084Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2395105Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2395240Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 2395293Domain d3huda1: 3hud A:1-162,A:339-374 [24735]
    Other proteins in same PDB: d3huda2, d3hudb2
    complexed with nad, zn

Details for d3huda1

PDB Entry: 3hud (more details), 3.2 Å

PDB Description: the structure of human beta 1 beta 1 alcohol dehydrogenase: catalytic effects of non-active-site substitutions
PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d3huda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3huda1 b.35.1.2 (A:1-162,A:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaXkfsldalithvlpfeki
negfdllhsgksirtvltf

SCOPe Domain Coordinates for d3huda1:

Click to download the PDB-style file with coordinates for d3huda1.
(The format of our PDB-style files is described here.)

Timeline for d3huda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3huda2