SCOP 1.73: Domain d1d1sb1: 1d1s B:1-162,B:339-374

Lineage for d1d1sb1 (1d1s B:1-162,B:339-374)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.35: GroES-like [50128] (2 superfamilies)
contains barrel, partly opened; n*=4, S*=8; meander
Superfamily b.35.1: GroES-like [50129] (2 families)
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
C-terminal domain is alpha/beta (classical Rossmann-fold)
Protein Alcohol dehydrogenase [50137] (9 species)
contains a Zn-finger subdomain, residues 94-117
Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
Domain d1d1sb1: 1d1s B:1-162,B:339-374 [24728]
Other proteins in same PDB: d1d1sa2, d1d1sb2, d1d1sc2, d1d1sd2

Details for d1d1sb1

PDB Entry: 1d1s (more details), 2.5 Å

PDB Description: wild-type human sigma (class iv) alcohol dehydrogenase

PDB Compounds: (B:) alcohol dehydrogenase class IV sigma chain

SCOP Domain Sequences for d1d1sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1sb1 b.35.1.2 (B:1-162,B:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
vladgttrftckgkpvhhfmntstfteytvvdessvakiddXkfdldqlithvlpfkkis
egfellnsgqsirtvltf

SCOP Domain Coordinates for d1d1sb1:

Click to download the PDB-style file with coordinates for d1d1sb1.
(The format of our PDB-style files is described here.)

Timeline for d1d1sb1: