Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.0: automated matches [227244] (1 protein) not a true family |
Protein automated matches [227010] (5 species) not a true protein |
Species Babesia bovis [TaxId:484906] [232544] (3 PDB entries) |
Domain d3kjrb2: 3kjr B:205-508 [247213] Other proteins in same PDB: d3kjra1, d3kjrb1 automated match to d3i3ra2 complexed with gol, nap, nhe |
PDB Entry: 3kjr (more details), 1.95 Å
SCOPe Domain Sequences for d3kjrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kjrb2 d.117.1.0 (B:205-508) automated matches {Babesia bovis [TaxId: 484906]} gtdisvpkpkyvacpgvrirnheefqyldiladvlshgvlkpnrtgtdayskfgyqmrfd lsrsfpllttkkvalrsiieellwfikgstngndllaknvriwelngrrdfldkngftdr eehdlgpiygfqwrhfgaeyldmhadytgkgidqlaeiinriktnpndrrlivcswnvsd lkkmalppchcffqfyvsdnklscmmhqrscdlglgvpfniasysiltamvaqvcglglg efvhnladahiyvdhvdavttqiariphpfprlrlnpdirniedftiddivvedyvshpp ipma
Timeline for d3kjrb2: