Lineage for d1d1tc1 (1d1t C:1-162,C:339-374)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461906Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 461907Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 461986Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (13 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 462004Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 462105Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (18 PDB entries)
  8. 462130Domain d1d1tc1: 1d1t C:1-162,C:339-374 [24721]
    Other proteins in same PDB: d1d1ta2, d1d1tb2, d1d1tc2, d1d1td2

Details for d1d1tc1

PDB Entry: 1d1t (more details), 2.4 Å

PDB Description: mutant of human sigma alcohol dehydrogenase with leucine at position 141

SCOP Domain Sequences for d1d1tc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1tc1 b.35.1.2 (C:1-162,C:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
vladgttrftckgkpvhhflntstfteytvvdessvakiddXkfdldqlithvlpfkkis
egfellnsgqsirtvltf

SCOP Domain Coordinates for d1d1tc1:

Click to download the PDB-style file with coordinates for d1d1tc1.
(The format of our PDB-style files is described here.)

Timeline for d1d1tc1: