Lineage for d1htba1 (1htb A:1-174,A:325-374)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13334Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 13335Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 13363Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 13364Protein Alcohol dehydrogenase [50137] (4 species)
  7. 13415Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (13 PDB entries)
  8. 13422Domain d1htba1: 1htb A:1-174,A:325-374 [24715]
    Other proteins in same PDB: d1htba2, d1htbb2

Details for d1htba1

PDB Entry: 1htb (more details), 2.4 Å

PDB Description: crystallization of human beta3 alcohol dehydrogenase (10 mg/ml) in 100 mm sodium phosphate (ph 7.5), 7.5 mm nad+ and 1 mm 4-iodopyrazole at 25 c

SCOP Domain Sequences for d1htba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htba1 b.35.1.2 (A:1-174,A:325-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcXkegip
klvadfmakkfsldalithvlpfekinegfdllhsgksictvltf

SCOP Domain Coordinates for d1htba1:

Click to download the PDB-style file with coordinates for d1htba1.
(The format of our PDB-style files is described here.)

Timeline for d1htba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htba2