Lineage for d3kebc_ (3keb C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1602651Species Chromobacterium violaceum [TaxId:536] [255907] (1 PDB entry)
  8. 1602654Domain d3kebc_: 3keb C: [247148]
    automated match to d2yzhd_
    complexed with cl, so4

Details for d3kebc_

PDB Entry: 3keb (more details), 1.8 Å

PDB Description: thiol peroxidase from chromobacterium violaceum
PDB Compounds: (C:) Probable thiol peroxidase

SCOPe Domain Sequences for d3kebc_:

Sequence, based on SEQRES records: (download)

>d3kebc_ c.47.1.0 (C:) automated matches {Chromobacterium violaceum [TaxId: 536]}
medfwvqygdemlpvigdfprkgdylpsfmlvddqkhdaalesfshtpklivtllsvded
ehagllllretrrfldswphlklivitvdspsslararhehglpniallstlrgrdfhkr
ygvliteyplsgytspaiiladaanvvhyserlantrdffdfdaiekllqegeq

Sequence, based on observed residues (ATOM records): (download)

>d3kebc_ c.47.1.0 (C:) automated matches {Chromobacterium violaceum [TaxId: 536]}
medfwvqygdemlpvigdfprkgdylpsfmlvddqkhdaalesfshtpklivtllsvded
ehagllllretrrfldswphlklivitvdspsslararhehglpniallstlrrdfhkry
gvliteyplsgytspaiiladaanvvhyserlantrdffdfdaiekllqegeq

SCOPe Domain Coordinates for d3kebc_:

Click to download the PDB-style file with coordinates for d3kebc_.
(The format of our PDB-style files is described here.)

Timeline for d3kebc_: