Lineage for d3k2hb1 (3k2h B:4-187)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2511486Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2511487Protein automated matches [190777] (27 species)
    not a true protein
  7. 2511574Species Babesia bovis [TaxId:484906] [232542] (3 PDB entries)
  8. 2511580Domain d3k2hb1: 3k2h B:4-187 [247100]
    Other proteins in same PDB: d3k2ha2, d3k2hb2
    automated match to d3i3ra1
    complexed with edo, lya, nap, ump

Details for d3k2hb1

PDB Entry: 3k2h (more details), 2.2 Å

PDB Description: co-crystal structure of dihydrofolate reductase/thymidylate synthase from babesia bovis with dump, pemetrexed and nadp
PDB Compounds: (B:) Dihydrofolate reductase/thymidylate synthase

SCOPe Domain Sequences for d3k2hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k2hb1 c.71.1.0 (B:4-187) automated matches {Babesia bovis [TaxId: 484906]}
syegcgdltifvavalnkvighknqipwphithdfrflrngttyippevlsknpdiqnvv
ifgrktyesipkaslplknrinvilsrtvkevpgclvyedlstairdlranvphnkifil
ggsflykevldnglcdkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfvi
yerk

SCOPe Domain Coordinates for d3k2hb1:

Click to download the PDB-style file with coordinates for d3k2hb1.
(The format of our PDB-style files is described here.)

Timeline for d3k2hb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3k2hb2